Recombinant Human Eosinophil cationic protein (ECP), Biotinylated

Produktübersicht

• Artikelname: Recombinant Human Eosinophil cationic protein (ECP), Biotinylated
• Artikelnummer: BYT-ORB3008902
• Hersteller Artikelnummer: orb3008902
• Alternativnummer: BYT-ORB3008902-1, BYT-ORB3008902-100, BYT-ORB3008902-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Eosinophil cationic protein, ECP, EC 3.1.27.-, Ribonuclease 3, RNase 3, RNASE3 ECP RNS3

Produktbeschreibung

This Recombinant Human Eosinophil cationic protein (ECP), Biotinylated spans the amino acid sequence from region 28-160. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: P12724
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)