Recombinant Human Eosinophil cationic protein (ECP), Biotinylated

Product Overview

• Article Name: Recombinant Human Eosinophil cationic protein (ECP), Biotinylated
• Biozol Catalog Number: BYT-ORB3008902
• Supplier Catalog Number: orb3008902
• Alternative Catalog Number: BYT-ORB3008902-1, BYT-ORB3008902-100, BYT-ORB3008902-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Eosinophil cationic protein, ECP, EC 3.1.27.-, Ribonuclease 3, RNase 3, RNASE3 ECP RNS3

Product Description

This Recombinant Human Eosinophil cationic protein (ECP), Biotinylated spans the amino acid sequence from region 28-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P12724
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)