Recombinant Human Creatine kinase B-type (KCRB), Biotinylated

Artikelnummer: BYT-ORB3008903
Artikelname: Recombinant Human Creatine kinase B-type (KCRB), Biotinylated
Artikelnummer: BYT-ORB3008903
Hersteller Artikelnummer: orb3008903
Alternativnummer: BYT-ORB3008903-1, BYT-ORB3008903-100, BYT-ORB3008903-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Creatine kinase B-type, EC 2.7.3.2, Brain creatine kinase, B-CK, Creatine kinase B chain, Creatine phosphokinase B-type, CPK-B, CKB CKBB
This Recombinant Human Creatine kinase B-type (KCRB), Biotinylated spans the amino acid sequence from region 2-381. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P12277
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: PFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTG
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)