Recombinant Human Creatine kinase B-type (KCRB), Biotinylated

Product Overview

• Article Name: Recombinant Human Creatine kinase B-type (KCRB), Biotinylated
• Biozol Catalog Number: BYT-ORB3008903
• Supplier Catalog Number: orb3008903
• Alternative Catalog Number: BYT-ORB3008903-1, BYT-ORB3008903-100, BYT-ORB3008903-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Creatine kinase B-type, EC 2.7.3.2, Brain creatine kinase, B-CK, Creatine kinase B chain, Creatine phosphokinase B-type, CPK-B, CKB CKBB

Product Description

This Recombinant Human Creatine kinase B-type (KCRB), Biotinylated spans the amino acid sequence from region 2-381. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P12277
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: PFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTG

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)