Recombinant Human Uridine 5-monophosphate synthase (UMPS), Biotinylated

Artikelnummer: BYT-ORB3008905
Artikelname: Recombinant Human Uridine 5-monophosphate synthase (UMPS), Biotinylated
Artikelnummer: BYT-ORB3008905
Hersteller Artikelnummer: orb3008905
Alternativnummer: BYT-ORB3008905-1, BYT-ORB3008905-100, BYT-ORB3008905-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Uridine 5-monophosphate synthase, UMP synthase, [Includes: Orotate phosphoribosyltransferase, OPRT, OPRTase, EC 2.4.2.10, Orotidine 5-phosphate decarboxylase, ODC, OMPD, EC 4.1.1.23, OMPdecase] UMPS OK/SW-cl.21
This Recombinant Human Uridine 5-monophosphate synthase (UMPS), Biotinylated spans the amino acid sequence from region 2-480. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P11172
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)