Recombinant Human Uridine 5-monophosphate synthase (UMPS), Biotinylated

Product Overview

• Article Name: Recombinant Human Uridine 5-monophosphate synthase (UMPS), Biotinylated
• Biozol Catalog Number: BYT-ORB3008905
• Supplier Catalog Number: orb3008905
• Alternative Catalog Number: BYT-ORB3008905-1, BYT-ORB3008905-100, BYT-ORB3008905-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Uridine 5-monophosphate synthase, UMP synthase, [Includes: Orotate phosphoribosyltransferase, OPRT, OPRTase, EC 2.4.2.10, Orotidine 5-phosphate decarboxylase, ODC, OMPD, EC 4.1.1.23, OMPdecase] UMPS OK/SW-cl.21

Product Description

This Recombinant Human Uridine 5-monophosphate synthase (UMPS), Biotinylated spans the amino acid sequence from region 2-480. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P11172
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: AVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCL

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)