Recombinant Human Histone H3.X (H3Y2), Biotinylated

Artikelnummer: BYT-ORB3008916
Artikelname: Recombinant Human Histone H3.X (H3Y2), Biotinylated
Artikelnummer: BYT-ORB3008916
Hersteller Artikelnummer: orb3008916
Alternativnummer: BYT-ORB3008916-1, BYT-ORB3008916-100, BYT-ORB3008916-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Histone H3.X, Histone H3.Y2, H3Y2
This Recombinant Human Histone H3.X (H3Y2), Biotinylated spans the amino acid sequence from region 2-147. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DPK5
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ARTKQTARKATAWQAPRKPLATKAARKRASPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRGEGAGEPTLLGNLAL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)