Recombinant Human Histone H3.X (H3Y2), Biotinylated

Catalog Number: BYT-ORB3008916
Article Name: Recombinant Human Histone H3.X (H3Y2), Biotinylated
Biozol Catalog Number: BYT-ORB3008916
Supplier Catalog Number: orb3008916
Alternative Catalog Number: BYT-ORB3008916-1, BYT-ORB3008916-100, BYT-ORB3008916-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Histone H3.X, Histone H3.Y2, H3Y2
This Recombinant Human Histone H3.X (H3Y2), Biotinylated spans the amino acid sequence from region 2-147. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DPK5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ARTKQTARKATAWQAPRKPLATKAARKRASPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRGEGAGEPTLLGNLAL
Application Notes: Biological Origin: Homo sapiens (Human)