Recombinant Human Histone H3.Y (H3Y1), Biotinylated

Artikelnummer: BYT-ORB3008918
Artikelname: Recombinant Human Histone H3.Y (H3Y1), Biotinylated
Artikelnummer: BYT-ORB3008918
Hersteller Artikelnummer: orb3008918
Alternativnummer: BYT-ORB3008918-1, BYT-ORB3008918-100, BYT-ORB3008918-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Histone H3.Y, Histone H3.Y1, H3Y1
This Recombinant Human Histone H3.Y (H3Y1), Biotinylated spans the amino acid sequence from region 2-136. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DPK2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ARTKQTARKATAWQAPRKPLATKAAGKRAPPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRREGP
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)