Recombinant Human Histone H3.Y (H3Y1), Biotinylated

Catalog Number: BYT-ORB3008918
Article Name: Recombinant Human Histone H3.Y (H3Y1), Biotinylated
Biozol Catalog Number: BYT-ORB3008918
Supplier Catalog Number: orb3008918
Alternative Catalog Number: BYT-ORB3008918-1, BYT-ORB3008918-100, BYT-ORB3008918-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Histone H3.Y, Histone H3.Y1, H3Y1
This Recombinant Human Histone H3.Y (H3Y1), Biotinylated spans the amino acid sequence from region 2-136. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DPK2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ARTKQTARKATAWQAPRKPLATKAAGKRAPPTGGIKKPHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRREGP
Application Notes: Biological Origin: Homo sapiens (Human)