Recombinant Human EEF1AKMT4-ECE2 readthrough transcript protein (EFCE2), partial, Biotinylated

Artikelnummer: BYT-ORB3008921
Artikelname: Recombinant Human EEF1AKMT4-ECE2 readthrough transcript protein (EFCE2), partial, Biotinylated
Artikelnummer: BYT-ORB3008921
Hersteller Artikelnummer: orb3008921
Alternativnummer: BYT-ORB3008921-1, BYT-ORB3008921-100, BYT-ORB3008921-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: EEF1AKMT4-ECE2 readthrough transcript protein, EC 3.4.24.71, [Includes: Methyltransferase-like region, EC 2.1.1.-, Endothelin-converting enzyme 2 region, EC 3.4.24.71] EEF1AKMT4-ECE2
This Recombinant Human EEF1AKMT4-ECE2 readthrough transcript protein (EFCE2), partial, Biotinylated spans the amino acid sequence from region 1-178. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DPD8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MASPGAGRAPPELPERNCGYREVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQARHAHVPQLRWETMDVRKLDFPSASFDVVLEKGTLDALLAGERDPWTVSSEGVHTVDQVLSEVGFQKGTRQLLGSRTQLE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)