Recombinant Human EEF1AKMT4-ECE2 readthrough transcript protein (EFCE2), partial, Biotinylated

Product Overview

• Article Name: Recombinant Human EEF1AKMT4-ECE2 readthrough transcript protein (EFCE2), partial, Biotinylated
• Biozol Catalog Number: BYT-ORB3008921
• Supplier Catalog Number: orb3008921
• Alternative Catalog Number: BYT-ORB3008921-1, BYT-ORB3008921-100, BYT-ORB3008921-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: EEF1AKMT4-ECE2 readthrough transcript protein, EC 3.4.24.71, [Includes: Methyltransferase-like region, EC 2.1.1.-, Endothelin-converting enzyme 2 region, EC 3.4.24.71] EEF1AKMT4-ECE2

Product Description

This Recombinant Human EEF1AKMT4-ECE2 readthrough transcript protein (EFCE2), partial, Biotinylated spans the amino acid sequence from region 1-178. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P0DPD8
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MASPGAGRAPPELPERNCGYREVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPEDRILVLGCGNSALSYELFLGGFPNVTSVDYSSVVVAAMQARHAHVPQLRWETMDVRKLDFPSASFDVVLEKGTLDALLAGERDPWTVSSEGVHTVDQVLSEVGFQKGTRQLLGSRTQLE

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)