Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial, Biotinylated

Artikelnummer: BYT-ORB3008923
Artikelname: Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial, Biotinylated
Artikelnummer: BYT-ORB3008923
Hersteller Artikelnummer: orb3008923
Alternativnummer: BYT-ORB3008923-1, BYT-ORB3008923-100, BYT-ORB3008923-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Endothelin-converting enzyme 2, ECE-2, EC 3.4.24.71, ECE2 KIAA0604 UNQ403/PRO740
This Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial, Biotinylated spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DPD6
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MNVALQELGAGSNMVEYKRATLRDEDAPETPVEGGASPDAMEVGKGASPFSPGPSPGMTPGTPRSSGLFWRVTCPHLRSISGLCSRTMVGFQKGTRQLLGSRTQLE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)