Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial, Biotinylated

Catalog Number: BYT-ORB3008923
Article Name: Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008923
Supplier Catalog Number: orb3008923
Alternative Catalog Number: BYT-ORB3008923-1, BYT-ORB3008923-100, BYT-ORB3008923-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Endothelin-converting enzyme 2, ECE-2, EC 3.4.24.71, ECE2 KIAA0604 UNQ403/PRO740
This Recombinant Human Endothelin-converting enzyme 2 (ECE2), partial, Biotinylated spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DPD6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNVALQELGAGSNMVEYKRATLRDEDAPETPVEGGASPDAMEVGKGASPFSPGPSPGMTPGTPRSSGLFWRVTCPHLRSISGLCSRTMVGFQKGTRQLLGSRTQLE
Application Notes: Biological Origin: Homo sapiens (Human)