Recombinant Human Chimeric ERCC6-PGBD3 protein (ERPG3), partial, Biotinylated

Artikelnummer: BYT-ORB3008925
Artikelname: Recombinant Human Chimeric ERCC6-PGBD3 protein (ERPG3), partial, Biotinylated
Artikelnummer: BYT-ORB3008925
Hersteller Artikelnummer: orb3008925
Alternativnummer: BYT-ORB3008925-1, BYT-ORB3008925-100, BYT-ORB3008925-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Chimeric ERCC6-PGBD3 protein, Chimeric CSB-PGBD3 protein, ERCC6
This Recombinant Human Chimeric ERCC6-PGBD3 protein (ERPG3), partial, Biotinylated spans the amino acid sequence from region 1-500. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DP91
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MPNEGIPHSSQTQEQDCLQSQPVSNNEEMAIKQESGGDGEVEEYLSFRSVGDGLSTSAVGCASAAPRRGPALLHIDRHQIQAVEPSAQALELQGLGVDVYDQDVLEQGVLQQVDNAIHEASRASQLVDVEKEYRSVLDDLTSCTTSLRQINKIIEQLSPQAATSRDINRKLDSVKRQKYNKEQQLKKITAKQKHLQAILGGAEVKIELDHASLEEDAEPGPSSLGSMLMPVQETAWEELIRTGQMTPFGTQIPQK
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)