Recombinant Human Chimeric ERCC6-PGBD3 protein (ERPG3), partial, Biotinylated

Catalog Number: BYT-ORB3008925
Article Name: Recombinant Human Chimeric ERCC6-PGBD3 protein (ERPG3), partial, Biotinylated
Biozol Catalog Number: BYT-ORB3008925
Supplier Catalog Number: orb3008925
Alternative Catalog Number: BYT-ORB3008925-1, BYT-ORB3008925-100, BYT-ORB3008925-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Chimeric ERCC6-PGBD3 protein, Chimeric CSB-PGBD3 protein, ERCC6
This Recombinant Human Chimeric ERCC6-PGBD3 protein (ERPG3), partial, Biotinylated spans the amino acid sequence from region 1-500. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DP91
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MPNEGIPHSSQTQEQDCLQSQPVSNNEEMAIKQESGGDGEVEEYLSFRSVGDGLSTSAVGCASAAPRRGPALLHIDRHQIQAVEPSAQALELQGLGVDVYDQDVLEQGVLQQVDNAIHEASRASQLVDVEKEYRSVLDDLTSCTTSLRQINKIIEQLSPQAATSRDINRKLDSVKRQKYNKEQQLKKITAKQKHLQAILGGAEVKIELDHASLEEDAEPGPSSLGSMLMPVQETAWEELIRTGQMTPFGTQIPQK
Application Notes: Biological Origin: Homo sapiens (Human)