Recombinant Human Immunoglobulin lambda constant 3 (IGLC3), Biotinylated

Artikelnummer: BYT-ORB3008929
Artikelname: Recombinant Human Immunoglobulin lambda constant 3 (IGLC3), Biotinylated
Artikelnummer: BYT-ORB3008929
Hersteller Artikelnummer: orb3008929
Alternativnummer: BYT-ORB3008929-1, BYT-ORB3008929-100, BYT-ORB3008929-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Immunoglobulin lambda constant 3, Ig lambda chain C region DOT, Ig lambda chain C region NEWM, Ig lambda-3 chain C regions, IGLC3
This Recombinant Human Immunoglobulin lambda constant 3 (IGLC3), Biotinylated spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DOY3
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)