Recombinant Human Immunoglobulin lambda constant 3 (IGLC3), Biotinylated

Catalog Number: BYT-ORB3008929
Article Name: Recombinant Human Immunoglobulin lambda constant 3 (IGLC3), Biotinylated
Biozol Catalog Number: BYT-ORB3008929
Supplier Catalog Number: orb3008929
Alternative Catalog Number: BYT-ORB3008929-1, BYT-ORB3008929-100, BYT-ORB3008929-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Immunoglobulin lambda constant 3, Ig lambda chain C region DOT, Ig lambda chain C region NEWM, Ig lambda-3 chain C regions, IGLC3
This Recombinant Human Immunoglobulin lambda constant 3 (IGLC3), Biotinylated spans the amino acid sequence from region 1-106. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DOY3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
Application Notes: Biological Origin: Homo sapiens (Human)