Recombinant Human Choriogonadotropin subunit beta 3 (CGB3), Biotinylated

Artikelnummer: BYT-ORB3008931
Artikelname: Recombinant Human Choriogonadotropin subunit beta 3 (CGB3), Biotinylated
Artikelnummer: BYT-ORB3008931
Hersteller Artikelnummer: orb3008931
Alternativnummer: BYT-ORB3008931-1, BYT-ORB3008931-100, BYT-ORB3008931-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Choriogonadotropin subunit beta 3, Choriogonadotropin subunit beta, CG-beta, Chorionic gonadotropin chain beta, CGB3 CGB, CGB5, CGB8
This Recombinant Human Choriogonadotropin subunit beta 3 (CGB3), Biotinylated spans the amino acid sequence from region 21-165. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DN86
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)