Recombinant Human Choriogonadotropin subunit beta 3 (CGB3), Biotinylated

Catalog Number: BYT-ORB3008931
Article Name: Recombinant Human Choriogonadotropin subunit beta 3 (CGB3), Biotinylated
Biozol Catalog Number: BYT-ORB3008931
Supplier Catalog Number: orb3008931
Alternative Catalog Number: BYT-ORB3008931-1, BYT-ORB3008931-100, BYT-ORB3008931-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Choriogonadotropin subunit beta 3, Choriogonadotropin subunit beta, CG-beta, Chorionic gonadotropin chain beta, CGB3 CGB, CGB5, CGB8
This Recombinant Human Choriogonadotropin subunit beta 3 (CGB3), Biotinylated spans the amino acid sequence from region 21-165. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DN86
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Application Notes: Biological Origin: Homo sapiens (Human)