Recombinant Human Thymosin beta-15C (TB15C)

Artikelnummer: BYT-ORB3009114
Artikelname: Recombinant Human Thymosin beta-15C (TB15C)
Artikelnummer: BYT-ORB3009114
Hersteller Artikelnummer: orb3009114
Alternativnummer: BYT-ORB3009114-1, BYT-ORB3009114-100, BYT-ORB3009114-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Thymosin beta-15C TMSB15C
This Recombinant Human Thymosin beta-15C (TB15C) spans the amino acid sequence from region 2-45. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DX04
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)