Recombinant Human Thymosin beta-15C (TB15C)

Catalog Number: BYT-ORB3009114
Article Name: Recombinant Human Thymosin beta-15C (TB15C)
Biozol Catalog Number: BYT-ORB3009114
Supplier Catalog Number: orb3009114
Alternative Catalog Number: BYT-ORB3009114-1, BYT-ORB3009114-100, BYT-ORB3009114-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Thymosin beta-15C TMSB15C
This Recombinant Human Thymosin beta-15C (TB15C) spans the amino acid sequence from region 2-45. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DX04
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS
Application Notes: Biological Origin: Homo sapiens (Human)