Recombinant Human Golgin subfamily A member 6-like protein 26 (GG6LZ)

Produktübersicht

• Artikelname: Recombinant Human Golgin subfamily A member 6-like protein 26 (GG6LZ)
• Artikelnummer: BYT-ORB3009115
• Hersteller Artikelnummer: orb3009115
• Alternativnummer: BYT-ORB3009115-1, BYT-ORB3009115-100, BYT-ORB3009115-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Golgin subfamily A member 6-like protein 26 GOLGA6L26

Produktbeschreibung

This Recombinant Human Golgin subfamily A member 6-like protein 26 (GG6LZ) spans the amino acid sequence from region 1-649. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: P0DX02
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MWPQPHLPTHPHLPTHPHLPTHPMMSKETRQSKLAEAKEQLTDHHPQTNPSVGTAASDTKKKKINNGTNPETTTSGGCHSPEDEQKASHQHQEALRRELEAQVHTIRILTCQKTELQMALYYSQHAVKQLEGEARDLISRLHDSWKFAGELEQALSAVATQKKKADRYIEELTKERDALSLELYRNTITDEELKEKNAKLQEKLQLVESEKSEIQLNVKELKRKLERAKLLLPQQQLQAEADHLGKELQSVSAKL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)