Recombinant Human Golgin subfamily A member 6-like protein 26 (GG6LZ)

Catalog Number: BYT-ORB3009115
Article Name: Recombinant Human Golgin subfamily A member 6-like protein 26 (GG6LZ)
Biozol Catalog Number: BYT-ORB3009115
Supplier Catalog Number: orb3009115
Alternative Catalog Number: BYT-ORB3009115-1, BYT-ORB3009115-100, BYT-ORB3009115-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Golgin subfamily A member 6-like protein 26 GOLGA6L26
This Recombinant Human Golgin subfamily A member 6-like protein 26 (GG6LZ) spans the amino acid sequence from region 1-649. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DX02
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MWPQPHLPTHPHLPTHPHLPTHPMMSKETRQSKLAEAKEQLTDHHPQTNPSVGTAASDTKKKKINNGTNPETTTSGGCHSPEDEQKASHQHQEALRRELEAQVHTIRILTCQKTELQMALYYSQHAVKQLEGEARDLISRLHDSWKFAGELEQALSAVATQKKKADRYIEELTKERDALSLELYRNTITDEELKEKNAKLQEKLQLVESEKSEIQLNVKELKRKLERAKLLLPQQQLQAEADHLGKELQSVSAKL
Application Notes: Biological Origin: Homo sapiens (Human)