Recombinant Human Histone H2B.N (H2BN1)

Artikelnummer: BYT-ORB3009118
Artikelname: Recombinant Human Histone H2B.N (H2BN1)
Artikelnummer: BYT-ORB3009118
Hersteller Artikelnummer: orb3009118
Alternativnummer: BYT-ORB3009118-1, BYT-ORB3009118-100, BYT-ORB3009118-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Histone H2B.N, H2B.N, H2B.N variant histone 1, H2BN1
This Recombinant Human Histone H2B.N (H2BN1) spans the amino acid sequence from region 1-118. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DW85
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MYFICLNDLRFPKNKTELYFPVKKKHEWANSATGKKRRWRKKRRKEAYFSYMGKILKQIHPDFSGRSWVLYALGALNAWQLEWVSLEAFRLSFYNHRRAITGREILGAVKQRSSQKSF
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)