Recombinant Human Histone H2B.N (H2BN1)

Catalog Number: BYT-ORB3009118
Article Name: Recombinant Human Histone H2B.N (H2BN1)
Biozol Catalog Number: BYT-ORB3009118
Supplier Catalog Number: orb3009118
Alternative Catalog Number: BYT-ORB3009118-1, BYT-ORB3009118-100, BYT-ORB3009118-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Histone H2B.N, H2B.N, H2B.N variant histone 1, H2BN1
This Recombinant Human Histone H2B.N (H2BN1) spans the amino acid sequence from region 1-118. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DW85
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MYFICLNDLRFPKNKTELYFPVKKKHEWANSATGKKRRWRKKRRKEAYFSYMGKILKQIHPDFSGRSWVLYALGALNAWQLEWVSLEAFRLSFYNHRRAITGREILGAVKQRSSQKSF
Application Notes: Biological Origin: Homo sapiens (Human)