Recombinant Human Speedy protein E8 (SPD8)

Artikelnummer: BYT-ORB3009134
Artikelname: Recombinant Human Speedy protein E8 (SPD8)
Artikelnummer: BYT-ORB3009134
Hersteller Artikelnummer: orb3009134
Alternativnummer: BYT-ORB3009134-1, BYT-ORB3009134-100, BYT-ORB3009134-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Speedy protein E8 SPDYE8
This Recombinant Human Speedy protein E8 (SPD8) spans the amino acid sequence from region 1-265. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DUD1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHW
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)