Recombinant Human Speedy protein E8 (SPD8)

Catalog Number: BYT-ORB3009134
Article Name: Recombinant Human Speedy protein E8 (SPD8)
Biozol Catalog Number: BYT-ORB3009134
Supplier Catalog Number: orb3009134
Alternative Catalog Number: BYT-ORB3009134-1, BYT-ORB3009134-100, BYT-ORB3009134-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Speedy protein E8 SPDYE8
This Recombinant Human Speedy protein E8 (SPD8) spans the amino acid sequence from region 1-265. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DUD1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHW
Application Notes: Biological Origin: Homo sapiens (Human)