Recombinant Human Lymphocyte antigen 6S (LY6S)

Artikelnummer: BYT-ORB3009135
Artikelname: Recombinant Human Lymphocyte antigen 6S (LY6S)
Artikelnummer: BYT-ORB3009135
Hersteller Artikelnummer: orb3009135
Alternativnummer: BYT-ORB3009135-1, BYT-ORB3009135-100, BYT-ORB3009135-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Lymphocyte antigen 6S LY6S
This Recombinant Human Lymphocyte antigen 6S (LY6S) spans the amino acid sequence from region 27-105. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DTL4
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LRCYRCLAVLEGASCSVVSCPFLDGVCVSQKVSVFGSKVRGENKLSLLSCQKDVGFPLLKLTSAVVDSQISCCKGDLCN
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)