Recombinant Human Lymphocyte antigen 6S (LY6S)

Catalog Number: BYT-ORB3009135
Article Name: Recombinant Human Lymphocyte antigen 6S (LY6S)
Biozol Catalog Number: BYT-ORB3009135
Supplier Catalog Number: orb3009135
Alternative Catalog Number: BYT-ORB3009135-1, BYT-ORB3009135-100, BYT-ORB3009135-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Lymphocyte antigen 6S LY6S
This Recombinant Human Lymphocyte antigen 6S (LY6S) spans the amino acid sequence from region 27-105. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DTL4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LRCYRCLAVLEGASCSVVSCPFLDGVCVSQKVSVFGSKVRGENKLSLLSCQKDVGFPLLKLTSAVVDSQISCCKGDLCN
Application Notes: Biological Origin: Homo sapiens (Human)