Recombinant Human PTTG1IP family member 2 (PTIP2), partial

Artikelnummer: BYT-ORB3009136
Artikelname: Recombinant Human PTTG1IP family member 2 (PTIP2), partial
Artikelnummer: BYT-ORB3009136
Hersteller Artikelnummer: orb3009136
Alternativnummer: BYT-ORB3009136-1, BYT-ORB3009136-100, BYT-ORB3009136-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: PTTG1IP family member 2 PTTG1IP2
This Recombinant Human PTTG1IP family member 2 (PTIP2), partial spans the amino acid sequence from region 27-97. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DTF9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: FSENGFIHSPRNNQKPRDGNEEECAVKKSCQLCTEDKKCVWCSEEKACKKYCFPYFGCRFSSIYWLNCKVD
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)