Recombinant Human PTTG1IP family member 2 (PTIP2), partial

Catalog Number: BYT-ORB3009136
Article Name: Recombinant Human PTTG1IP family member 2 (PTIP2), partial
Biozol Catalog Number: BYT-ORB3009136
Supplier Catalog Number: orb3009136
Alternative Catalog Number: BYT-ORB3009136-1, BYT-ORB3009136-100, BYT-ORB3009136-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: PTTG1IP family member 2 PTTG1IP2
This Recombinant Human PTTG1IP family member 2 (PTIP2), partial spans the amino acid sequence from region 27-97. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DTF9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FSENGFIHSPRNNQKPRDGNEEECAVKKSCQLCTEDKKCVWCSEEKACKKYCFPYFGCRFSSIYWLNCKVD
Application Notes: Biological Origin: Homo sapiens (Human)