Recombinant Human G antigen 4 (GAGE4)

Artikelnummer: BYT-ORB3009138
Artikelname: Recombinant Human G antigen 4 (GAGE4)
Artikelnummer: BYT-ORB3009138
Hersteller Artikelnummer: orb3009138
Alternativnummer: BYT-ORB3009138-1, BYT-ORB3009138-100, BYT-ORB3009138-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: G antigen 4, Cancer/testis antigen 4.4, CT4.4, GAGE4
This Recombinant Human G antigen 4 (GAGE4) spans the amino acid sequence from region 1-117. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DSO3
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)