Recombinant Human G antigen 4 (GAGE4)

Product Overview

• Article Name: Recombinant Human G antigen 4 (GAGE4)
• Biozol Catalog Number: BYT-ORB3009138
• Supplier Catalog Number: orb3009138
• Alternative Catalog Number: BYT-ORB3009138-1, BYT-ORB3009138-100, BYT-ORB3009138-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: G antigen 4, Cancer/testis antigen 4.4, CT4.4, GAGE4

Product Description

This Recombinant Human G antigen 4 (GAGE4) spans the amino acid sequence from region 1-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P0DSO3
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)