Recombinant Human Putative taste receptor type 2 member 33 (T2R33), partial

Produktübersicht

• Artikelname: Recombinant Human Putative taste receptor type 2 member 33 (T2R33), partial
• Artikelnummer: BYT-ORB3009140
• Hersteller Artikelnummer: orb3009140
• Alternativnummer: BYT-ORB3009140-1, BYT-ORB3009140-100, BYT-ORB3009140-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Putative taste receptor type 2 member 33, T2R33, hGR33, TAS2R33

Produktbeschreibung

This Recombinant Human Putative taste receptor type 2 member 33 (T2R33), partial spans the amino acid sequence from region 149-181. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: P0DSN6
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MDERVWTKEYEGNVTWKIKLRNAIHLSSLTVTT

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)