Putative taste receptor type 2 member 33, T2R33, hGR33, TAS2R33
This Recombinant Human Putative taste receptor type 2 member 33 (T2R33), partial spans the amino acid sequence from region 149-181. Purity: Greater than 85% as determined by SDS-PAGE.
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source:
Homo sapiens (Human)
Purity:
Greater than 85% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Sequence:
MDERVWTKEYEGNVTWKIKLRNAIHLSSLTVTT
Application Notes:
Biological Origin: Homo sapiens (Human)
* VAT and and shipping costs not included. Errors and price changes excepted
