Recombinant Human Putative uncharacterized protein CDRT15P3 (CB27B)

Artikelnummer: BYT-ORB3009146
Artikelname: Recombinant Human Putative uncharacterized protein CDRT15P3 (CB27B)
Artikelnummer: BYT-ORB3009146
Hersteller Artikelnummer: orb3009146
Alternativnummer: BYT-ORB3009146-1, BYT-ORB3009146-100, BYT-ORB3009146-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Putative uncharacterized protein CDRT15P3 CDRT15P3 C2orf27B
This Recombinant Human Putative uncharacterized protein CDRT15P3 (CB27B) spans the amino acid sequence from region 1-209. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DPF6
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELEEAPEPSCRCPGTAQDQPSEELPDFMAPPVEPPASALELKVWLELEVAERGGQHSSSQQLPHCSQSWAQWKLWRQRPGFAIWAPLPHWRGTSLIQQSSSPAAEGPAATAAGAVCLPAGGAGEQEKEPVSRGSSRSSCSQRRPPPPGMEVCPQLGIWAICP
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)