Recombinant Human Putative uncharacterized protein CDRT15P3 (CB27B)

Catalog Number: BYT-ORB3009146
Article Name: Recombinant Human Putative uncharacterized protein CDRT15P3 (CB27B)
Biozol Catalog Number: BYT-ORB3009146
Supplier Catalog Number: orb3009146
Alternative Catalog Number: BYT-ORB3009146-1, BYT-ORB3009146-100, BYT-ORB3009146-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Putative uncharacterized protein CDRT15P3 CDRT15P3 C2orf27B
This Recombinant Human Putative uncharacterized protein CDRT15P3 (CB27B) spans the amino acid sequence from region 1-209. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DPF6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELEEAPEPSCRCPGTAQDQPSEELPDFMAPPVEPPASALELKVWLELEVAERGGQHSSSQQLPHCSQSWAQWKLWRQRPGFAIWAPLPHWRGTSLIQQSSSPAAEGPAATAAGAVCLPAGGAGEQEKEPVSRGSSRSSCSQRRPPPPGMEVCPQLGIWAICP
Application Notes: Biological Origin: Homo sapiens (Human)