Recombinant Human NBPF family member NBPF20 (NBPFK), partial

Artikelnummer: BYT-ORB3009147
Artikelname: Recombinant Human NBPF family member NBPF20 (NBPFK), partial
Artikelnummer: BYT-ORB3009147
Hersteller Artikelnummer: orb3009147
Alternativnummer: BYT-ORB3009147-1, BYT-ORB3009147-100, BYT-ORB3009147-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: NBPF family member NBPF20, Neuroblastoma breakpoint family member 20, NBPF20
This Recombinant Human NBPF family member NBPF20 (NBPFK), partial spans the amino acid sequence from region 5109-5207. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DPF2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: KRRRGRKEGEEDQNPPCPRLNGVLMEVEEPEVLQDSLDGCYSTPSMYFELPDSFQHYRSVFYSFEEQHISFALYVDNRFFTLTVTSLHLVFQMGVIFPQ
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)