Recombinant Human NBPF family member NBPF20 (NBPFK), partial

Catalog Number: BYT-ORB3009147
Article Name: Recombinant Human NBPF family member NBPF20 (NBPFK), partial
Biozol Catalog Number: BYT-ORB3009147
Supplier Catalog Number: orb3009147
Alternative Catalog Number: BYT-ORB3009147-1, BYT-ORB3009147-100, BYT-ORB3009147-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: NBPF family member NBPF20, Neuroblastoma breakpoint family member 20, NBPF20
This Recombinant Human NBPF family member NBPF20 (NBPFK), partial spans the amino acid sequence from region 5109-5207. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DPF2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KRRRGRKEGEEDQNPPCPRLNGVLMEVEEPEVLQDSLDGCYSTPSMYFELPDSFQHYRSVFYSFEEQHISFALYVDNRFFTLTVTSLHLVFQMGVIFPQ
Application Notes: Biological Origin: Homo sapiens (Human)