Recombinant Human Putative uncharacterized protein MED14OS (M14OS)

Produktübersicht

• Artikelname: Recombinant Human Putative uncharacterized protein MED14OS (M14OS)
• Artikelnummer: BYT-ORB3009151
• Hersteller Artikelnummer: orb3009151
• Alternativnummer: BYT-ORB3009151-1, BYT-ORB3009151-100, BYT-ORB3009151-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Putative uncharacterized protein MED14OS, MED14 antisense gene protein 1, MED14 opposite strand protein, MED14OS MED14-AS1

Produktbeschreibung

This Recombinant Human Putative uncharacterized protein MED14OS (M14OS) spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: P0DP75
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MRSSSLPGARSPRRNGSGQSRHRLPPGRLRTGSRAPTAEARPHVARSPPTPGTGARGGGRRGWGGSRAAPQRGSCASANAQKQLRQTAATYMLTARGGSRSAERKGDLQRTFRQVGQTMPMVPPLDFTMNAASVE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)