Recombinant Human Putative uncharacterized protein MED14OS (M14OS)

Catalog Number: BYT-ORB3009151
Article Name: Recombinant Human Putative uncharacterized protein MED14OS (M14OS)
Biozol Catalog Number: BYT-ORB3009151
Supplier Catalog Number: orb3009151
Alternative Catalog Number: BYT-ORB3009151-1, BYT-ORB3009151-100, BYT-ORB3009151-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Putative uncharacterized protein MED14OS, MED14 antisense gene protein 1, MED14 opposite strand protein, MED14OS MED14-AS1
This Recombinant Human Putative uncharacterized protein MED14OS (M14OS) spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DP75
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MRSSSLPGARSPRRNGSGQSRHRLPPGRLRTGSRAPTAEARPHVARSPPTPGTGARGGGRRGWGGSRAAPQRGSCASANAQKQLRQTAATYMLTARGGSRSAERKGDLQRTFRQVGQTMPMVPPLDFTMNAASVE
Application Notes: Biological Origin: Homo sapiens (Human)