Recombinant Human Transmembrane protein 225B (T225B), partial

Artikelnummer: BYT-ORB3009152
Artikelname: Recombinant Human Transmembrane protein 225B (T225B), partial
Artikelnummer: BYT-ORB3009152
Hersteller Artikelnummer: orb3009152
Alternativnummer: BYT-ORB3009152-1, BYT-ORB3009152-100, BYT-ORB3009152-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Transmembrane protein 225B TMEM225B
This Recombinant Human Transmembrane protein 225B (T225B), partial spans the amino acid sequence from region 168-221. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DP42
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: CLIQEMVCPCWHLLSTSQSMEEDHGSLYLDNLESLGGEPSSVQKETQVTAETVI
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)