Recombinant Human Transmembrane protein 225B (T225B), partial

Catalog Number: BYT-ORB3009152
Article Name: Recombinant Human Transmembrane protein 225B (T225B), partial
Biozol Catalog Number: BYT-ORB3009152
Supplier Catalog Number: orb3009152
Alternative Catalog Number: BYT-ORB3009152-1, BYT-ORB3009152-100, BYT-ORB3009152-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Transmembrane protein 225B TMEM225B
This Recombinant Human Transmembrane protein 225B (T225B), partial spans the amino acid sequence from region 168-221. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DP42
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: CLIQEMVCPCWHLLSTSQSMEEDHGSLYLDNLESLGGEPSSVQKETQVTAETVI
Application Notes: Biological Origin: Homo sapiens (Human)