Recombinant Human C1GALT1-specific chaperone 1-like protein (C1C1L), partial

Produktübersicht

• Artikelname: Recombinant Human C1GALT1-specific chaperone 1-like protein (C1C1L), partial
• Artikelnummer: BYT-ORB3009155
• Hersteller Artikelnummer: orb3009155
• Alternativnummer: BYT-ORB3009155-1, BYT-ORB3009155-100, BYT-ORB3009155-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: C1GALT1-specific chaperone 1-like protein C1GALT1C1L

Produktbeschreibung

This Recombinant Human C1GALT1-specific chaperone 1-like protein (C1C1L), partial spans the amino acid sequence from region 30-315. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: P0DN25
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: HIRHRGQTQDHEHHHLRPPNRNDFLNTSKVILLELSKSIRVFCIIFGESEDESYWAVLKETWTKHCDKAELYDTKNDNLFNIESNDRWVQMRTAYKYVFEKYGDNYNWFFLALPTTFAVIENLKYLLFTRDASQPFYLGHTVIFGDLEYVTVEGGIVLSRELMKRLNRLLDNSETCADQSVIWKLSEDKQLAICLKYAGVHAENAEDYEGRDVFNTKPIAQLIEEALSNNPQQVVEGCCSDMAITFNGLTPQKME

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)