Recombinant Human C1GALT1-specific chaperone 1-like protein (C1C1L), partial

Catalog Number: BYT-ORB3009155
Article Name: Recombinant Human C1GALT1-specific chaperone 1-like protein (C1C1L), partial
Biozol Catalog Number: BYT-ORB3009155
Supplier Catalog Number: orb3009155
Alternative Catalog Number: BYT-ORB3009155-1, BYT-ORB3009155-100, BYT-ORB3009155-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: C1GALT1-specific chaperone 1-like protein C1GALT1C1L
This Recombinant Human C1GALT1-specific chaperone 1-like protein (C1C1L), partial spans the amino acid sequence from region 30-315. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DN25
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: HIRHRGQTQDHEHHHLRPPNRNDFLNTSKVILLELSKSIRVFCIIFGESEDESYWAVLKETWTKHCDKAELYDTKNDNLFNIESNDRWVQMRTAYKYVFEKYGDNYNWFFLALPTTFAVIENLKYLLFTRDASQPFYLGHTVIFGDLEYVTVEGGIVLSRELMKRLNRLLDNSETCADQSVIWKLSEDKQLAICLKYAGVHAENAEDYEGRDVFNTKPIAQLIEEALSNNPQQVVEGCCSDMAITFNGLTPQKME
Application Notes: Biological Origin: Homo sapiens (Human)