Recombinant Human Putative protein ATXN8OS (AT8OS)

Produktübersicht

• Artikelname: Recombinant Human Putative protein ATXN8OS (AT8OS)
• Artikelnummer: BYT-ORB3009161
• Hersteller Artikelnummer: orb3009161
• Alternativnummer: BYT-ORB3009161-1, BYT-ORB3009161-100, BYT-ORB3009161-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Putative protein ATXN8OS, ATXN8 opposite strand, Spinocerebellar ataxia 8, kelch-like 1 antisense, ATXN8OS KLHL1AS SCA8

Produktbeschreibung

This Recombinant Human Putative protein ATXN8OS (AT8OS) spans the amino acid sequence from region 1-200. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: P0DMR3
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MPCPGAPCCSLVATGSRVPFSGLKEEEEEDGEDDEEEEEEGFFQKVLTPLLSWLLSRRLWLGPQCSKLPLPSCCRQPPPAGPPVEGDGWLKSFQRSRRMCFTSKSFRPEPDMLYAQKAKGWQLTQDSGGWEVQDQCTRIWSKENLLALNTHSRRQKGKRENKVCVSTWQKSRGDRTYSSMATTPSMTKILEGCMYRKLKC

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)