Recombinant Human Putative protein ATXN8OS (AT8OS)

Product Overview

• Article Name: Recombinant Human Putative protein ATXN8OS (AT8OS)
• Biozol Catalog Number: BYT-ORB3009161
• Supplier Catalog Number: orb3009161
• Alternative Catalog Number: BYT-ORB3009161-1, BYT-ORB3009161-100, BYT-ORB3009161-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Putative protein ATXN8OS, ATXN8 opposite strand, Spinocerebellar ataxia 8, kelch-like 1 antisense, ATXN8OS KLHL1AS SCA8

Product Description

This Recombinant Human Putative protein ATXN8OS (AT8OS) spans the amino acid sequence from region 1-200. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P0DMR3
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MPCPGAPCCSLVATGSRVPFSGLKEEEEEDGEDDEEEEEEGFFQKVLTPLLSWLLSRRLWLGPQCSKLPLPSCCRQPPPAGPPVEGDGWLKSFQRSRRMCFTSKSFRPEPDMLYAQKAKGWQLTQDSGGWEVQDQCTRIWSKENLLALNTHSRRQKGKRENKVCVSTWQKSRGDRTYSSMATTPSMTKILEGCMYRKLKC

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)