Recombinant Human Secretoglobin family 1C member 2 (SG1C2)

Artikelnummer: BYT-ORB3009162
Artikelname: Recombinant Human Secretoglobin family 1C member 2 (SG1C2)
Artikelnummer: BYT-ORB3009162
Hersteller Artikelnummer: orb3009162
Alternativnummer: BYT-ORB3009162-1, BYT-ORB3009162-100, BYT-ORB3009162-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Secretoglobin family 1C member 2 SCGB1C2
This Recombinant Human Secretoglobin family 1C member 2 (SG1C2) spans the amino acid sequence from region 24-95. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DMR2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EDNDEFFMDFLQTLLVGTPEELYEGTLGKYNVNEDAKAAMTELKSCRDGLQPMHKAELVKLLVQVLGSQDGA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)