Recombinant Human Secretoglobin family 1C member 2 (SG1C2)

Catalog Number: BYT-ORB3009162
Article Name: Recombinant Human Secretoglobin family 1C member 2 (SG1C2)
Biozol Catalog Number: BYT-ORB3009162
Supplier Catalog Number: orb3009162
Alternative Catalog Number: BYT-ORB3009162-1, BYT-ORB3009162-100, BYT-ORB3009162-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Secretoglobin family 1C member 2 SCGB1C2
This Recombinant Human Secretoglobin family 1C member 2 (SG1C2) spans the amino acid sequence from region 24-95. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DMR2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EDNDEFFMDFLQTLLVGTPEELYEGTLGKYNVNEDAKAAMTELKSCRDGLQPMHKAELVKLLVQVLGSQDGA
Application Notes: Biological Origin: Homo sapiens (Human)